PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BL_DAA2104F5.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 264aa    MW: 29256.9 Da    PI: 8.69
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BL_DAA2104F5.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-1780124147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg++T++E+  +v+++ ++G++ W+tIar ++ gRt++++k++w+++
  Traes_2BL_DAA2104F5.1  80 RGKMTPQEESTIVQLHSLWGNR-WSTIARSLP-GRTDNEIKNYWRTH 124
                            89********************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.4263974IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.3E-105887IPR009057Homeodomain-like
SuperFamilySSF466891.97E-1960128IPR009057Homeodomain-like
PROSITE profilePS5129424.69675129IPR017930Myb domain
SMARTSM007172.0E-1579127IPR001005SANT/Myb domain
PfamPF002497.3E-1580124IPR001005SANT/Myb domain
CDDcd001677.12E-1182124No hitNo description
Gene3DG3DSA:1.10.10.603.6E-1988125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
GVRAINGGGG RAARGLLGEA GRRVEERPVD HPGRQAAPGP CRPARRREVE LRLQAHRCLK  60
RSGKSCRLRW VNYLRPDLKR GKMTPQEEST IVQLHSLWGN RWSTIARSLP GRTDNEIKNY  120
WRTHYKKGKP SKNIERARAR FLMQRREMQQ QQQQQKLLLG QVKDVELPGA TVSDDVDEKM  180
DGAVGPAATA LADHGHEELI MQDVLDFLCP MSCALLHSAG QTGSCGASTS EEYGSTEDDG  240
ATWGSLWNLE DVAHDGDGGA CALW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-166112740106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581410.11e-86PREDICTED: myb-related protein 340
TrEMBLW5BG150.0W5BG15_WHEAT; Uncharacterized protein
STRINGSi010822m1e-79(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.13e-42myb domain protein 121
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]